LRRC57 antibody (N-Term)

Catalog No. ABIN631803

Product Details anti-LRRC57 Antibody

Target: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC57 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC57 antibody was raised against the N terminal of LRRC57

Purification: Affinity purified

Immunogen: LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC57 Blocking Peptide, catalog no. 33R-6050, is also available for use as a blocking control in assays to test for specificity of this LRRC57 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC57 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC57

Target: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Alternative Name: LRRC57 (LRRC57 Products)

Synonyms: zgc:92240 antibody, 2810002D13Rik antibody, AA407405 antibody, RGD1307128 antibody, leucine rich repeat containing 57 antibody, leucine rich repeat containing 57 L homeolog antibody, lrrc57 antibody, lrrc57.L antibody, LRRC57 antibody, Lrrc57 antibody

Background: LRRC57 is a member of the leucine-rich repeat family of proteins, which are known to be involved in protein-protein interactions.

Molecular Weight: 27 kDa (MW of target protein)