LCN8 antibody (N-Term)

Catalog No. ABIN631798

Product Details anti-LCN8 Antibody

Target: LCN8 (Lipocalin 8 (LCN8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCN8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Lipocalin 8 antibody was raised against the N terminal of LCN8

Purification: Affinity purified

Immunogen: Lipocalin 8 antibody was raised using the N terminal of LCN8 corresponding to a region with amino acids EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipocalin 8 Blocking Peptide, catalog no. 33R-2370, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCN8

Target: LCN8 (Lipocalin 8 (LCN8))

Alternative Name: Lipocalin 8 (LCN8 Products)

Synonyms: ESP20.5 antibody, EP17 antibody, LCN5 antibody, 9230106L18Rik antibody, Lcn5 antibody, mEP17 antibody, RGD1306747 antibody, lipocalin 8 antibody, LCN8 antibody, Lcn8 antibody

Background: Members of the lipocalin family, such as LCN8, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx.

Molecular Weight: 17 kDa (MW of target protein)