C7orf43 antibody (Middle Region)

Catalog No. ABIN631797

Product Details anti-C7orf43 Antibody

Target: C7orf43 (Chromosome 7 Open Reading Frame 43 (C7orf43))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C7orf43 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C7 ORF43 antibody was raised against the middle region of C7 rf43

Purification: Affinity purified

Immunogen: C7 ORF43 antibody was raised using the middle region of C7 rf43 corresponding to a region with amino acids DLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C7ORF43 Blocking Peptide, catalog no. 33R-2071, is also available for use as a blocking control in assays to test for specificity of this C7ORF43 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C7orf43

Target: C7orf43 (Chromosome 7 Open Reading Frame 43 (C7orf43))

Alternative Name: C7ORF43 (C7orf43 Products)

Synonyms: chromosome 3 open reading frame, human C7orf43 antibody, chromosome 7 open reading frame 43 antibody, C3H7orf43 antibody, c7orf43 antibody, C7orf43 antibody

Background: The function of Chromosome 7 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 62 kDa (MW of target protein)