ATXN7L1 antibody (Middle Region)

Catalog No. ABIN631793

Product Details anti-ATXN7L1 Antibody

Target: ATXN7L1 (Ataxin 7-Like 1 (ATXN7L1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATXN7L1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATXN7 L1 antibody was raised against the middle region of ATXN7 1

Purification: Affinity purified

Immunogen: ATXN7 L1 antibody was raised using the middle region of ATXN7 1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATXN7L1 Blocking Peptide, catalog no. 33R-4717, is also available for use as a blocking control in assays to test for specificity of this ATXN7L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATXN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATXN7L1

Target: ATXN7L1 (Ataxin 7-Like 1 (ATXN7L1))

Alternative Name: ATXN7L1 (ATXN7L1 Products)

Synonyms: ATXN7L4 antibody, 2810423G08Rik antibody, Atxn7l4 antibody, ATXN7L1 antibody, RGD1305730 antibody, RGD1564242 antibody, ataxin 7 like 1 antibody, ataxin 7-like 1 antibody, ataxin-7-like protein 1 antibody, ATXN7L1 antibody, Atxn7l1 antibody, atxn7l1 antibody, LOC100598692 antibody

Background: The function of ATXN7L1 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 16 kDa (MW of target protein)