LOC284009 antibody (N-Term)

Catalog No. ABIN631790

Product Details anti-LOC284009 Antibody

Target: LOC284009 (Hypothetical Protein LOC284009 (LOC284009))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LOC284009 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LOC284009 antibody was raised against the N terminal of LOC284009

Purification: Affinity purified

Immunogen: LOC284009 antibody was raised using the N terminal of LOC284009 corresponding to a region with amino acids IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPDI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC284009 Blocking Peptide, catalog no. 33R-4129, is also available for use as a blocking control in assays to test for specificity of this LOC284009 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC284009 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LOC284009

Target: LOC284009 (Hypothetical Protein LOC284009 (LOC284009))

Alternative Name: LOC284009 (LOC284009 Products)

Background: The function of LOC284009 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 17 kDa (MW of target protein)