POC1B antibody (N-Term)

Catalog No. ABIN631788

Product Details anti-POC1B Antibody

Target: POC1B (POC1 Centriolar Protein Homolog B (POC1B))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POC1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR51 B antibody was raised against the N terminal of WDR51

Purification: Affinity purified

Immunogen: WDR51 B antibody was raised using the N terminal of WDR51 corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR51B Blocking Peptide, catalog no. 33R-3452, is also available for use as a blocking control in assays to test for specificity of this WDR51B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POC1B

Target: POC1B (POC1 Centriolar Protein Homolog B (POC1B))

Alternative Name: WDR51B (POC1B Products)

Synonyms: PIX1 antibody, TUWD12 antibody, WDR51B antibody, 4933430F16Rik antibody, Wdr51b antibody, fl36w17 antibody, wdr51b antibody, wu:fl36w17 antibody, zgc:63538 antibody, POC1 centriolar protein B antibody, POC1B antibody, Poc1b antibody, poc1b antibody

Background: WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.

Molecular Weight: 54 kDa (MW of target protein)