DCAF12 antibody (N-Term)

Catalog No. ABIN631786

Product Details anti-DCAF12 Antibody

Target: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCAF12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR40 A antibody was raised against the N terminal of WDR40

Purification: Affinity purified

Immunogen: WDR40 A antibody was raised using the N terminal of WDR40 corresponding to a region with amino acids ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR40A Blocking Peptide, catalog no. 33R-1481, is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCAF12

Target: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Alternative Name: WDR40A (DCAF12 Products)

Synonyms: CT102 antibody, KIAA1892 antibody, TCC52 antibody, WDR40A antibody, 1500001L20Rik antibody, 5830424K06Rik antibody, AA420338 antibody, AI851081 antibody, Wdr40a antibody, wdr40a antibody, wu:fb93d04 antibody, zgc:154031 antibody, wdr40b antibody, dcaf12 antibody, wdr40a-a antibody, DDB1 and CUL4 associated factor 12 antibody, DDB1 and CUL4 associated factor 12 L homeolog antibody, DCAF12 antibody, Dcaf12 antibody, dcaf12 antibody, dcaf12.L antibody

Background: WDR40A is believed to be involved in protein binding.

Molecular Weight: 50 kDa (MW of target protein)