KLHL32 antibody

Catalog No. ABIN631778

Product Details anti-KLHL32 Antibody

Target: KLHL32 (Kelch-Like 32 (KLHL32))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL32 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: KLHL32 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL32 Blocking Peptide, catalog no. 33R-2225, is also available for use as a blocking control in assays to test for specificity of this KLHL32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL32

Target: KLHL32 (Kelch-Like 32 (KLHL32))

Alternative Name: KLHL32 (KLHL32 Products)

Synonyms: 6430524H05Rik antibody, D4Ertd389e antibody, Gm1356 antibody, mKIAA1900 antibody, zgc:158866 antibody, BKLHD5 antibody, KIAA1900 antibody, UG0030H05 antibody, dJ21F7.1 antibody, RGD1310364 antibody, kelch like family member 32 antibody, kelch-like 32 antibody, kelch-like family member 32 antibody, kelch like family member 32 L homeolog antibody, KLHL32 antibody, Klhl32 antibody, klhl32 antibody, klhl32.L antibody

Background: The specific function of KLHL32 is not yet known.

Molecular Weight: 70 kDa (MW of target protein)