Primary Retinal Dysplasia (PRD) (Middle Region) antibody

Catalog No. ABIN631772

Product Details

Target: Primary Retinal Dysplasia (PRD)

Binding Specificity: Middle Region

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: PRD antibody was raised against the middle region of PRD

Purification: Affinity purified

Immunogen: PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRD Blocking Peptide, catalog no. 33R-6573, is also available for use as a blocking control in assays to test for specificity of this PRD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Primary Retinal Dysplasia (PRD)

Alternative Name: PRD (PRD Products)

Background: Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.

Molecular Weight: 65 kDa (MW of target protein)