Primary Retinal Dysplasia (PRD) (Middle Region) antibody
-
- Target See all Primary Retinal Dysplasia (PRD) Antibodies
- Primary Retinal Dysplasia (PRD)
-
Binding Specificity
- Middle Region
-
Reactivity
- Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRD antibody was raised against the middle region of PRD
- Purification
- Affinity purified
- Immunogen
- PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL
- Top Product
- Discover our top product PRD Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRD Blocking Peptide, catalog no. 33R-6573, is also available for use as a blocking control in assays to test for specificity of this PRD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Primary Retinal Dysplasia (PRD)
- Alternative Name
- PRD (PRD Products)
- Background
- Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.
- Molecular Weight
- 65 kDa (MW of target protein)
-