PRPSAP2 antibody (N-Term)

Catalog No. ABIN631768

Product Details anti-PRPSAP2 Antibody

Target: PRPSAP2 (phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRPSAP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRPSAP2 antibody was raised against the N terminal of PRPSAP2

Purification: Affinity purified

Immunogen: PRPSAP2 antibody was raised using the N terminal of PRPSAP2 corresponding to a region with amino acids MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPSAP2 Blocking Peptide, catalog no. 33R-5987, is also available for use as a blocking control in assays to test for specificity of this PRPSAP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPSAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRPSAP2

Target: PRPSAP2 (phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2))

Alternative Name: PRPSAP2 (PRPSAP2 Products)

Synonyms: PAP41 antibody, A230054F23Rik antibody, Pap41 antibody, phosphoribosyl pyrophosphate synthetase associated protein 2 antibody, phosphoribosyl pyrophosphate synthetase-associated protein 2 antibody, PRPSAP2 antibody, Prpsap2 antibody

Background: The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD.

Molecular Weight: 41 kDa (MW of target protein)