PRR19 antibody (N-Term)
-
- Target See all PRR19 products
- PRR19 (Proline Rich 19 (PRR19))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRR19 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MGC70924 antibody was raised against the N terminal Of Mgc70924
- Purification
- Affinity purified
- Immunogen
- MGC70924 antibody was raised using the N terminal Of Mgc70924 corresponding to a region with amino acids MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MGC70924 Blocking Peptide, catalog no. 33R-5880, is also available for use as a blocking control in assays to test for specificity of this MGC70924 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC70924 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRR19 (Proline Rich 19 (PRR19))
- Alternative Name
- MGC70924 (PRR19 Products)
- Synonyms
- EG623131 antibody, MGC188639 antibody, proline rich 19 antibody, PRR19 antibody, Prr19 antibody
- Background
- The function of MGC70924 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 39 kDa (MW of target protein)
-