EIF5 antibody (N-Term)

Catalog No. ABIN631763

Product Details anti-EIF5 Antibody

Target: EIF5 (Eukaryotic Translation Initiation Factor 5 (EIF5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF5 antibody was raised against the N terminal of EIF5

Purification: Affinity purified

Immunogen: EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF5 Blocking Peptide, catalog no. 33R-8921, is also available for use as a blocking control in assays to test for specificity of this EIF5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF5

Target: EIF5 (Eukaryotic Translation Initiation Factor 5 (EIF5))

Alternative Name: EIF5 (EIF5 Products)

Synonyms: fb37c12 antibody, fb54h04 antibody, zgc:56606 antibody, zgc:77026 antibody, wu:fb37c12 antibody, wu:fb54h04 antibody, CG9177 antibody, Dmel\\CG9177 antibody, EIf5 antibody, anon-EST:fe3C6 antibody, eIF-5 antibody, EIF-5 antibody, EIF-5A antibody, 2810011H21Rik antibody, D12Ertd549e antibody, eukaryotic translation initiation factor 5 antibody, CG9177 gene product from transcript CG9177-RD antibody, eukaryotic translation initiation factor 5 S homeolog antibody, Eukaryotic initiation factor-5 antibody, eif5 antibody, EIF5 antibody, eIF5 antibody, eif5.S antibody, Eif5 antibody

Background: EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex.

Molecular Weight: 49 kDa (MW of target protein)