KLRAQ1 antibody (N-Term)

Catalog No. ABIN631762

Product Details anti-KLRAQ1 Antibody

Target: KLRAQ1 (KLRAQ Motif Containing 1 (KLRAQ1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLRAQ1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC128 antibody was raised against the N terminal of CCDC128

Purification: Affinity purified

Immunogen: CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC128 Blocking Peptide, catalog no. 33R-4637, is also available for use as a blocking control in assays to test for specificity of this CCDC128 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC128 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLRAQ1

Target: KLRAQ1 (KLRAQ Motif Containing 1 (KLRAQ1))

Alternative Name: CCDC128 (KLRAQ1 Products)

Synonyms: KLRAQ1 antibody, CCDC128 antibody, ccdc128 antibody, klraq1 antibody, 1110018J12Rik antibody, AI426045 antibody, AW550781 antibody, Ccdc128 antibody, Klraq1 antibody, protein phosphatase 1 regulatory subunit 21 antibody, protein phosphatase 1 regulatory subunit 21 L homeolog antibody, protein phosphatase 1, regulatory subunit 21 antibody, PPP1R21 antibody, ppp1r21.L antibody, Ppp1r21 antibody

Background: The function of CCDC128 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 87 kDa (MW of target protein)