SPATA17 antibody (C-Term)

Catalog No. ABIN631760

Product Details anti-SPATA17 Antibody

Target: SPATA17 (Spermatogenesis Associated 17 (SPATA17))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPATA17 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPATA17 antibody was raised against the C terminal of SPATA17

Purification: Affinity purified

Immunogen: SPATA17 antibody was raised using the C terminal of SPATA17 corresponding to a region with amino acids NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPATA17 Blocking Peptide, catalog no. 33R-6793, is also available for use as a blocking control in assays to test for specificity of this SPATA17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPATA17

Target: SPATA17 (Spermatogenesis Associated 17 (SPATA17))

Alternative Name: SPATA17 (SPATA17 Products)

Synonyms: IQCH antibody, MSRG-11 antibody, MSRG11 antibody, RP11-144C20.1 antibody, 1700065F16Rik antibody, 4930504I07Rik antibody, 4930513F16Rik antibody, spermatogenesis associated 17 antibody, SPATA17 antibody, Spata17 antibody

Background: SPATA17 contains 3 IQ domains. The function of the SPATA17 protein is not known.

Molecular Weight: 43 kDa (MW of target protein)