VARS antibody (Middle Region)

Catalog No. ABIN631756

Product Details anti-VARS Antibody

Target: VARS (Valyl-tRNA Synthetase (VARS))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VARS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VARS antibody was raised against the middle region of VARS

Purification: Affinity purified

Immunogen: VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VARS Blocking Peptide, catalog no. 33R-9521, is also available for use as a blocking control in assays to test for specificity of this VARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VARS

Target: VARS (Valyl-tRNA Synthetase (VARS))

Alternative Name: VARS (VARS Products)

Synonyms: G7A antibody, VARS1 antibody, VARS2 antibody, VARS antibody, Bat6 antibody, D17H6S56E antibody, G7a antibody, Vars2 antibody, vars1 antibody, vars2 antibody, CHUNP6879 antibody, im:7137378 antibody, wu:fb07a11 antibody, wu:fb07d10 antibody, TrsVal antibody, BEST:LD45671 antibody, CG4062 antibody, Dmel\\CG4062 antibody, VRS antibody, ValRS antibody, l(2)03531 antibody, l(2)rI255 antibody, ld45671 antibody, ECK4251 antibody, JW4215 antibody, val-act antibody, T5E21.11 antibody, T5E21_11 antibody, TWIN 2 antibody, VALRS antibody, VALYL TRNA SYNTHETASE antibody, valyl-tRNA synthetase antibody, Valyl-tRNA synthetase antibody, valyl-tRNA synthetase S homeolog antibody, hypothetical protein antibody, valyl-tRNA synthetase 2, mitochondrial antibody, valyl-tRNA synthetase / valine-tRNA ligase (VALRS) antibody, VARS antibody, Vars antibody, vars antibody, ValRS antibody, vars.S antibody, MW0078 antibody, Pnap_3169 antibody, valS antibody, Fnod_0343 antibody, Cyan7425_1070 antibody, Tola_0553 antibody, Slip_0680 antibody, Astex_3136 antibody, ML5_3395 antibody, VARS2 antibody, TWN2 antibody

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Molecular Weight: 140 kDa (MW of target protein)