VARS antibody (Middle Region)

Catalog No. ABIN631756

Product Details anti-VARS Antibody

Target: VARS (Valyl-tRNA Synthetase (VARS))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VARS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VARS antibody was raised against the middle region of VARS

Purification: Affinity purified

Immunogen: VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VARS Blocking Peptide, catalog no. 33R-9521, is also available for use as a blocking control in assays to test for specificity of this VARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VARS

Target: VARS (Valyl-tRNA Synthetase (VARS))

Alternative Name: VARS (VARS Products)

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Molecular Weight: 140 kDa (MW of target protein)