IARS antibody (N-Term)

Catalog No. ABIN631752

Product Details anti-IARS Antibody

Target: IARS (Isoleucyl-tRNA Synthetase (IARS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IARS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IARS antibody was raised against the N terminal of IARS

Purification: Affinity purified

Immunogen: IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IARS Blocking Peptide, catalog no. 33R-8554, is also available for use as a blocking control in assays to test for specificity of this IARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IARS

Target: IARS (Isoleucyl-tRNA Synthetase (IARS))

Alternative Name: IARS (IARS Products)

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS.

Molecular Weight: 144 kDa (MW of target protein)