IARS antibody (N-Term)

Catalog No. ABIN631752

Product Details anti-IARS Antibody

Target: IARS (Isoleucyl-tRNA Synthetase (IARS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IARS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IARS antibody was raised against the N terminal of IARS

Purification: Affinity purified

Immunogen: IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IARS Blocking Peptide, catalog no. 33R-8554, is also available for use as a blocking control in assays to test for specificity of this IARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IARS

Target: IARS (Isoleucyl-tRNA Synthetase (IARS))

Alternative Name: IARS (IARS Products)

Synonyms: fi46h05 antibody, zgc:63790 antibody, wu:fi46h05 antibody, K19E20.18 antibody, K19E20_18 antibody, ovule abortion 2 antibody, ECK0027 antibody, ilvS antibody, JW0024 antibody, An08g06770 antibody, AO090012000505 antibody, 2510016L12Rik antibody, AI327140 antibody, AU044614 antibody, E430001P04Rik antibody, ILRS antibody, Iarsl antibody, IARS1 antibody, ILERS antibody, IRS antibody, PRO0785 antibody, isoleucyl-tRNA synthetase antibody, tRNA synthetase class I (I, L, M and V) family protein antibody, isoleucine--tRNA ligase antibody, isoleucyl-tRNA synthetase, cytoplasmic antibody, isoleucine-tRNA synthetase antibody, iars antibody, IARS antibody, OVA2 antibody, ileS antibody, MBAR_RS19160 antibody, Rmag_0340 antibody, ANI_1_964074 antibody, CHLREDRAFT_106327 antibody, EDI_049880 antibody, OE_RS08520 antibody, AOR_1_1912194 antibody, Iars antibody

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS.

Molecular Weight: 144 kDa (MW of target protein)