ELP2 antibody
-
- Target See all ELP2 Antibodies
- ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ELP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ELP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT
- Top Product
- Discover our top product ELP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ELP2 Blocking Peptide, catalog no. 33R-2389, is also available for use as a blocking control in assays to test for specificity of this ELP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))
- Alternative Name
- ELP2 (ELP2 Products)
- Synonyms
- zgc:153559 antibody, SHINC-2 antibody, STATIP1 antibody, StIP antibody, AU023723 antibody, Epl2 antibody, StIP1 antibody, Statip1 antibody, F14J22.24 antibody, elongator protein 2 antibody, elongator acetyltransferase complex subunit 2 antibody, elongator protein 2 antibody, elp2 antibody, ELP2 antibody, Elp2 antibody
- Background
- ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
- Molecular Weight
- 92 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus
-