MASA antibody (N-Term)

Catalog No. ABIN631750

Product Details anti-MASA Antibody

Target: MASA (ENOPH1) (Enolase-Phosphatase 1 (ENOPH1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MASA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ENOPH1 antibody was raised against the N terminal of ENOPH1

Purification: Affinity purified

Immunogen: ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENOPH1 Blocking Peptide, catalog no. 33R-3937, is also available for use as a blocking control in assays to test for specificity of this ENOPH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MASA

Target: MASA (ENOPH1) (Enolase-Phosphatase 1 (ENOPH1))

Alternative Name: ENOPH1 (ENOPH1 Products)

Synonyms: E1 antibody, MASA antibody, MST145 antibody, mtnC antibody, 2310057D15Rik antibody, BB183658 antibody, C81437 antibody, RGD1309016 antibody, masa antibody, zgc:91991 antibody, enoph1 antibody, enolase-phosphatase 1 antibody, enolase-phosphatase 1 S homeolog antibody, Enolase-phosphatase E1 antibody, ENOPH1 antibody, enoph1 antibody, Enoph1 antibody, enoph1.S antibody, enoph antibody

Background: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process