GPN2 antibody (Middle Region)

Catalog No. ABIN631748

Product Details anti-GPN2 Antibody

Target: GPN2 (GPN-Loop GTPase 2 (GPN2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GPN2 antibody was raised against the middle region of GPN2

Purification: Affinity purified

Immunogen: GPN2 antibody was raised using the middle region of GPN2 corresponding to a region with amino acids VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPN2 Blocking Peptide, catalog no. 33R-9680, is also available for use as a blocking control in assays to test for specificity of this GPN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPN2

Target: GPN2 (GPN-Loop GTPase 2 (GPN2))

Alternative Name: GPN2 (GPN2 Products)

Synonyms: ATPBD1B antibody, Atpbd1b antibody, RGD1311749 antibody, atpbd1b antibody, zgc:92877 antibody, AI838661 antibody, R74630 antibody, RP23-137L22.10 antibody, GPN-loop GTPase 2 antibody, GPN-loop GTPase 2 S homeolog antibody, G-patch domain containing 3 antibody, GPN2 antibody, Gpn2 antibody, gpn2.S antibody, gpn2 antibody, GPATCH3 antibody

Background: The function of GPN protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 34 kDa (MW of target protein)