RCC2 antibody (Middle Region)

Catalog No. ABIN631742

Product Details anti-RCC2 Antibody

Target: RCC2 (Regulator of Chromosome Condensation 2 (RCC2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RCC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RCC2 antibody was raised against the middle region of RCC2

Purification: Affinity purified

Immunogen: RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RCC2 Blocking Peptide, catalog no. 33R-7978, is also available for use as a blocking control in assays to test for specificity of this RCC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RCC2

Target: RCC2 (Regulator of Chromosome Condensation 2 (RCC2))

Alternative Name: RCC2 (RCC2 Products)

Synonyms: RCC2 antibody, TD-60 antibody, 2610510H01Rik antibody, 2610529N02Rik antibody, AA536646 antibody, AA675016 antibody, Td60 antibody, mKIAA1470 antibody, td-60 antibody, wu:fb36a03 antibody, zgc:77115 antibody, RGD1309986 antibody, regulator of chromosome condensation 2 antibody, regulator of chromosome condensation 2 L homeolog antibody, RCC2 antibody, Rcc2 antibody, rcc2 antibody, rcc2.L antibody

Background: RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Molecular Weight: 56 kDa (MW of target protein)