TRAPPC6B antibody (Middle Region)
-
- Target See all TRAPPC6B Antibodies
- TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRAPPC6B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRAPPC6 B antibody was raised against the middle region of TRAPPC6
- Purification
- Affinity purified
- Immunogen
- TRAPPC6 B antibody was raised using the middle region of TRAPPC6 corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
- Top Product
- Discover our top product TRAPPC6B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRAPPC6B Blocking Peptide, catalog no. 33R-9336, is also available for use as a blocking control in assays to test for specificity of this TRAPPC6B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))
- Alternative Name
- TRAPPC6B (TRAPPC6B Products)
- Background
- TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.
- Molecular Weight
- 15 kDa (MW of target protein)
-