FBXO28 antibody (Middle Region)
-
- Target See all FBXO28 Antibodies
- FBXO28 (F-Box Protein 28 (FBXO28))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO28 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO28 antibody was raised against the middle region of FBXO28
- Purification
- Affinity purified
- Immunogen
- FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
- Top Product
- Discover our top product FBXO28 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO28 Blocking Peptide, catalog no. 33R-2539, is also available for use as a blocking control in assays to test for specificity of this FBXO28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO28 (F-Box Protein 28 (FBXO28))
- Alternative Name
- FBXO28 (FBXO28 Products)
- Synonyms
- fd49h06 antibody, wu:fd49h06 antibody, FBXO28 antibody, CENP-30 antibody, Fbx28 antibody, 4833428J17Rik antibody, 5730505P19Rik antibody, D1Ertd578e antibody, mKIAA0483 antibody, F-box protein 28 antibody, F-box protein 28 L homeolog antibody, fbxo28 antibody, fbxo28.L antibody, FBXO28 antibody, Fbxo28 antibody
- Background
- Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Molecular Weight
- 41 kDa (MW of target protein)
-