FLJ25791 (Middle Region) antibody
Reactivity: Human
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
-
- Target
- FLJ25791
- Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- FLJ25791 antibody was raised against the middle region of Flj25791
- Purification
- Affinity purified
- Immunogen
- FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL
-
anti-FLJ25791 (Middle Region) antibody
Reactivity: Human, Rabbit, Cow, Dog, Horse, Mouse WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FLJ25791 Blocking Peptide, catalog no. 33R-2831, is also available for use as a blocking control in assays to test for specificity of this FLJ25791 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25791 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLJ25791
- Background
- FLJ25791 is believed to be involved in nucleotide kinase activity and nucleotide binding
- Molecular Weight
- 36 kDa (MW of target protein)
-
You are here:
