HP1BP3 antibody (Middle Region)
-
- Target See all HP1BP3 products
- HP1BP3 (Heterochromatin Protein 1, Binding Protein 3 (HP1BP3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HP1BP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HP1 BP3 antibody was raised against the middle region of HP1 P3
- Purification
- Affinity purified
- Immunogen
- HP1 BP3 antibody was raised using the middle region of HP1 P3 corresponding to a region with amino acids QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HP1BP3 Blocking Peptide, catalog no. 33R-7796, is also available for use as a blocking control in assays to test for specificity of this HP1BP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP0 P3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HP1BP3 (Heterochromatin Protein 1, Binding Protein 3 (HP1BP3))
- Alternative Name
- HP1BP3 (HP1BP3 Products)
- Synonyms
- HP1-BP74 antibody, Hp1bp74 antibody, heterochromatin protein 1 binding protein 3 antibody, heterochromatin protein 1, binding protein 3 antibody, HP1BP3 antibody, Hp1bp3 antibody
- Background
- HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.
- Molecular Weight
- 61 kDa (MW of target protein)
-