NET1 antibody (N-Term)

Catalog No. ABIN631712

Product Details anti-NET1 Antibody

Target: NET1 (Neuroepithelial Cell Transforming 1 (NET1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NET1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NET1 antibody was raised against the N terminal of NET1

Purification: Affinity purified

Immunogen: NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NET1 Blocking Peptide, catalog no. 33R-7919, is also available for use as a blocking control in assays to test for specificity of this NET1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NET1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NET1

Target: NET1 (Neuroepithelial Cell Transforming 1 (NET1))

Alternative Name: NET1 (NET1 Products)

Synonyms: arhgef8 antibody, net1a antibody, xNET1 antibody, DKFZp459I0423 antibody, NET1 antibody, ARHGEF8 antibody, NET1A antibody, 0610025H04Rik antibody, 9530071N24Rik antibody, AI604373 antibody, AU015857 antibody, Net1a antibody, mNET1 antibody, wu:fb13g03 antibody, wu:fb25c11 antibody, zgc:92121 antibody, neuroepithelial cell transforming 1 antibody, neuroepithelial cell-transforming gene 1 protein antibody, neuroepithelial cell transforming 1 L homeolog antibody, neuroepithelial cell transforming gene 1 antibody, net1 antibody, EDI_348570 antibody, NET1 antibody, Net1 antibody, net1.L antibody

Background: NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway