DENND1A antibody (N-Term)
-
- Target See all DENND1A Antibodies
- DENND1A (DENN/MADD Domain Containing 1A (DENND1A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DENND1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DENND1 A antibody was raised against the N terminal of DENND1
- Purification
- Affinity purified
- Immunogen
- DENND1 A antibody was raised using the N terminal of DENND1 corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML
- Top Product
- Discover our top product DENND1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DENND1A Blocking Peptide, catalog no. 33R-7139, is also available for use as a blocking control in assays to test for specificity of this DENND1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DENND1A (DENN/MADD Domain Containing 1A (DENND1A))
- Alternative Name
- DENND1A (DENND1A Products)
- Synonyms
- RGD1307927 antibody, FAM31A antibody, KIAA1608 antibody, RP11-230L22.3 antibody, 6030446I19Rik antibody, connecdenn antibody, fam31a antibody, DENN domain containing 1A antibody, DENN/MADD domain containing 1A antibody, DENN domain-containing protein 1A antibody, DENN domain containing 1A S homeolog antibody, Dennd1a antibody, DENND1A antibody, dennd1a antibody, LOC100512328 antibody, dennd1a.S antibody
- Background
- DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.
- Molecular Weight
- 110 kDa (MW of target protein)
-