NEDD1 antibody (N-Term)

Catalog No. ABIN631703

Product Details anti-NEDD1 Antibody

Target: NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEDD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NEDD1 antibody was raised against the N terminal of NEDD1

Purification: Affinity purified

Immunogen: NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEDD1 Blocking Peptide, catalog no. 33R-6323, is also available for use as a blocking control in assays to test for specificity of this NEDD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEDD1

Target: NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))

Alternative Name: NEDD1 (NEDD1 Products)

Synonyms: MGC81767 antibody, MGC145237 antibody, GCP-WD antibody, TUBGCP7 antibody, neural precursor cell expressed, developmentally down-regulated 1 L homeolog antibody, neural precursor cell expressed, developmentally down-regulated 1 antibody, cilia and flagella associated protein 54 antibody, neural precursor cell expressed, developmentally down-regulated gene 1 antibody, nedd1.L antibody, nedd1 antibody, CFAP54 antibody, NEDD1 antibody, Nedd1 antibody

Background: NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: M Phase