CIB3 antibody (N-Term)

Catalog No. ABIN631697

Product Details anti-CIB3 Antibody

Target: CIB3 (Calcium and Integrin Binding Protein 3 (CIB3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CIB3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CIB3 antibody was raised against the N terminal of CIB3

Purification: Affinity purified

Immunogen: CIB3 antibody was raised using the N terminal of CIB3 corresponding to a region with amino acids QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CIB3 Blocking Peptide, catalog no. 33R-7504, is also available for use as a blocking control in assays to test for specificity of this CIB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CIB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CIB3

Target: CIB3 (Calcium and Integrin Binding Protein 3 (CIB3))

Alternative Name: CIB3 (CIB3 Products)

Synonyms: C730014M21Rik antibody, Gm1107 antibody, KIP3 antibody, calcium and integrin binding family member 3 antibody, Cib3 antibody, CIB3 antibody, cib3 antibody

Background: The specific function of CIB3 is not yet known.

Molecular Weight: 22 kDa (MW of target protein)