CIB3 antibody (N-Term)
-
- Target See all CIB3 Antibodies
- CIB3 (Calcium and Integrin Binding Protein 3 (CIB3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CIB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CIB3 antibody was raised against the N terminal of CIB3
- Purification
- Affinity purified
- Immunogen
- CIB3 antibody was raised using the N terminal of CIB3 corresponding to a region with amino acids QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG
- Top Product
- Discover our top product CIB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CIB3 Blocking Peptide, catalog no. 33R-7504, is also available for use as a blocking control in assays to test for specificity of this CIB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CIB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CIB3 (Calcium and Integrin Binding Protein 3 (CIB3))
- Alternative Name
- CIB3 (CIB3 Products)
- Synonyms
- C730014M21Rik antibody, Gm1107 antibody, KIP3 antibody, calcium and integrin binding family member 3 antibody, Cib3 antibody, CIB3 antibody, cib3 antibody
- Background
- The specific function of CIB3 is not yet known.
- Molecular Weight
- 22 kDa (MW of target protein)
-