GNB1 antibody

Catalog No. ABIN631690

Product Details anti-GNB1 Antibody

Target: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNB1 Blocking Peptide, catalog no. 33R-6416, is also available for use as a blocking control in assays to test for specificity of this GNB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNB1

Target: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Alternative Name: GNB1 (GNB1 Products)

Synonyms: gnb1 antibody, wu:fb50b09 antibody, wu:fj94h04 antibody, AA409223 antibody, C77571 antibody, Gnb-1 antibody, XGB1 antibody, xgbeta1 antibody, GNB1x antibody, fb39f01 antibody, gnb1l antibody, wu:fb39f01 antibody, wu:fb98e06 antibody, wu:fj09d12 antibody, zgc:55774 antibody, G protein subunit beta 1 antibody, guanine nucleotide binding protein (G protein), beta polypeptide 1a antibody, guanine nucleotide binding protein (G protein), beta 1 antibody, guanine nucleotide binding protein (G protein), beta polypeptide 1 S homeolog antibody, guanine nucleotide binding protein (G protein), beta polypeptide 1b antibody, GNB1 antibody, gnb1a antibody, Gnb1 antibody, gnb1.S antibody, gnb1b antibody

Background: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling, SARS-CoV-2 Protein Interactome