NT5DC1 antibody (N-Term)

Catalog No. ABIN631687

Product Details anti-NT5DC1 Antibody

Target: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NT5DC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NT5 DC1 antibody was raised against the N terminal of NT5 C1

Purification: Affinity purified

Immunogen: NT5 DC1 antibody was raised using the N terminal of NT5 C1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NT5DC1 Blocking Peptide, catalog no. 33R-2811, is also available for use as a blocking control in assays to test for specificity of this NT5DC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NT5DC1

Target: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Alternative Name: NT5DC1 (NT5DC1 Products)

Synonyms: C6orf200 antibody, LP2642 antibody, NT5C2L1 antibody, 6030401B09Rik antibody, AW987726 antibody, Nt5c2l1 antibody, fj64b02 antibody, si:dkey-121j17.1 antibody, wu:fj64b02 antibody, Nt5dc1 antibody, cb904 antibody, id:ibd5113 antibody, nt5c2 antibody, zgc:92102 antibody, 5'-nucleotidase domain containing 1 antibody, 5'-nucleotidase domain-containing protein 1 antibody, 5'-nucleotidase, cytosolic II, like 1 antibody, NT5DC1 antibody, nt5dc1.L antibody, Nt5dc1 antibody, nt5dc1 antibody, LOC100714559 antibody, nt5c2l1 antibody

Background: While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family.

Molecular Weight: 52 kDa (MW of target protein)