ERI2 antibody (Middle Region)
-
- Target See all ERI2 (EXOD1) products
- ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERI2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ERI2 antibody was raised against the middle region of ERI2
- Purification
- Affinity purified
- Immunogen
- ERI2 antibody was raised using the middle region of ERI2 corresponding to a region with amino acids LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ERI2 Blocking Peptide, catalog no. 33R-5308, is also available for use as a blocking control in assays to test for specificity of this ERI2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))
- Alternative Name
- ERI2 (EXOD1 Products)
- Synonyms
- exod1 antibody, EXOD1 antibody, Exod1 antibody, 4933424N09Rik antibody, mKIAA1504 antibody, eri2 antibody, ERI1 exoribonuclease family member 2 L homeolog antibody, ERI1 exoribonuclease family member 2 antibody, exoribonuclease 2 antibody, eri2.L antibody, ERI2 antibody, Eri2 antibody, eri2 antibody
- Background
- EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.
- Molecular Weight
- 37 kDa (MW of target protein)
-