APRT antibody (N-Term)
-
- Target See all APRT Antibodies
- APRT (Adenine Phosphoribosyltransferase (APRT))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APRT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- APRT antibody was raised against the N terminal of APRT
- Purification
- Affinity purified
- Immunogen
- APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK
- Top Product
- Discover our top product APRT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APRT Blocking Peptide, catalog no. 33R-1105, is also available for use as a blocking control in assays to test for specificity of this APRT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APRT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APRT (Adenine Phosphoribosyltransferase (APRT))
- Alternative Name
- APRT (APRT Products)
- Synonyms
- Tb07.43M14.200 antibody, Tb07.43M14.180 antibody, C85684 antibody, AMP antibody, APRTD antibody, adenine phosphoribosyltransferase antibody, adenine phosphoribosyl transferase antibody, CND05020 antibody, Tb927.7.1790 antibody, Tb927.7.1780 antibody, Arnit_0941 antibody, Saut_1231 antibody, Fbal_1180 antibody, PH_RS07970 antibody, PF_RS08760 antibody, PAB_RS02560 antibody, Aprt antibody, APRT antibody
- Background
- Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-