PES1 antibody
-
- Target See all PES1 Antibodies
- PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PES1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PES1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE
- Top Product
- Discover our top product PES1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PES1 Blocking Peptide, catalog no. 33R-4489, is also available for use as a blocking control in assays to test for specificity of this PES1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PES1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))
- Alternative Name
- PES1 (PES1 Products)
- Synonyms
- PES antibody, pes antibody, pes1 antibody, pescadillo ribosomal biogenesis factor 1 antibody, pescadillo ribosomal biogenesis factor 1 S homeolog antibody, Pescadillo antibody, PES1 antibody, Pes1 antibody, pes1.S antibody, pesc antibody
- Background
- PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.
- Molecular Weight
- 68 kDa (MW of target protein)
-