HAO1 antibody
-
- Target See all HAO1 Antibodies
- HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HAO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
- Top Product
- Discover our top product HAO1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HAO1 Blocking Peptide, catalog no. 33R-3411, is also available for use as a blocking control in assays to test for specificity of this HAO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))
- Alternative Name
- HAO1 (HAO1 Products)
- Background
- Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-