Clavesin 1 antibody (N-Term)

Catalog No. ABIN631673

Product Details anti-Clavesin 1 Antibody

Target: Clavesin 1 (CLVS1)

Binding Specificity: N-Term

Reactivity: Rat, Mouse, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Clavesin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RLBP1 L1 antibody was raised against the N terminal of RLBP1 1

Purification: Affinity purified

Immunogen: RLBP1 L1 antibody was raised using the N terminal of RLBP1 1 corresponding to a region with amino acids NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RLBP1L1 Blocking Peptide, catalog no. 33R-6686, is also available for use as a blocking control in assays to test for specificity of this RLBP1L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RLBP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Clavesin 1

Target: Clavesin 1 (CLVS1)

Alternative Name: RLBP1L1 (CLVS1 Products)

Synonyms: RLBP1L1 antibody, rlbp1l1 antibody, CRALBPL antibody, 4933402J24Rik antibody, Clvl1 antibody, Rlbp1l1 antibody, Clavesin-1 antibody, RGD1564200 antibody, clavesin 1 antibody, clavesin 1 L homeolog antibody, CLVS1 antibody, clvs1.L antibody, Clvs1 antibody

Background: RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas.

Molecular Weight: 41 kDa (MW of target protein)