PDZK1 antibody (N-Term)

Catalog No. ABIN631670

Product Details anti-PDZK1 Antibody

Target: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDZK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDZK1 antibody was raised against the n terminal of PDZK1

Purification: Affinity purified

Immunogen: PDZK1 antibody was raised using the N terminal of PDZK1 corresponding to a region with amino acids MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDZK1 Blocking Peptide, catalog no. 33R-6566, is also available for use as a blocking control in assays to test for specificity of this PDZK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDZK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDZK1

Target: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Alternative Name: PDZK1 (PDZK1 Products)

Synonyms: xpdzk1 antibody, PDZK1 antibody, CAP70 antibody, CLAMP antibody, NHERF-3 antibody, NHERF3 antibody, PDZD1 antibody, 1700023D20Rik antibody, 2610507N21Rik antibody, 4921513F16Rik antibody, AI267131 antibody, AI314638 antibody, AL022680 antibody, D3Ertd537e antibody, Pdzd1 antibody, mPDZK1 antibody, Clamp antibody, PDZ domain containing 1 antibody, PDZ domain containing 1 L homeolog antibody, PDZK1 antibody, pdzk1.L antibody, pdzk1 antibody, Pdzk1 antibody

Background: PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins.

Molecular Weight: 41 kDa (MW of target protein)