PCGF5 antibody (N-Term)

Catalog No. ABIN631667

Product Details anti-PCGF5 Antibody

Target: PCGF5 (Polycomb Group Ring Finger 5 (PCGF5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCGF5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCGF5 antibody was raised against the N terminal of PCGF5

Purification: Affinity purified

Immunogen: PCGF5 antibody was raised using the N terminal of PCGF5 corresponding to a region with amino acids ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCGF5 Blocking Peptide, catalog no. 33R-1571, is also available for use as a blocking control in assays to test for specificity of this PCGF5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCGF5

Target: PCGF5 (Polycomb Group Ring Finger 5 (PCGF5))

Alternative Name: PCGF5 (PCGF5 Products)

Synonyms: RNF159 antibody, 0610009F02Rik antibody, 1110054A01Rik antibody, 5830406C17Rik antibody, 5830443C21Rik antibody, 9530023M17Rik antibody, AI324127 antibody, pcgf5 antibody, zgc:136815 antibody, zgc:194668 antibody, zgc:194700 antibody, polycomb group ring finger 5 antibody, polycomb group ring finger 5b antibody, polycomb group ring finger 5a antibody, PCGF5 antibody, Pcgf5 antibody, pcgf5b antibody, pcgf5a antibody

Background: PCGF5 contains 1 RING-type zinc finger. It is probable component of some Polycomb group (PcG) multiprotein complex, a complex required to maintain the transcriptionally repressive state of some genes.

Molecular Weight: 30 kDa (MW of target protein)