RNF39 antibody (N-Term)

Catalog No. ABIN631666

Product Details anti-RNF39 Antibody

Target: RNF39 (Ring Finger Protein 39 (RNF39))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF39 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RNF39 antibody was raised against the N terminal of RNF39

Purification: Affinity purified

Immunogen: RNF39 antibody was raised using the N terminal of RNF39 corresponding to a region with amino acids EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF39 Blocking Peptide, catalog no. 33R-2444, is also available for use as a blocking control in assays to test for specificity of this RNF39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF39

Target: RNF39 (Ring Finger Protein 39 (RNF39))

Alternative Name: RNF39 (RNF39 Products)

Synonyms: HZF antibody, HZFW antibody, LIRF antibody, Hzfw1 antibody, Lirf antibody, BC038661 antibody, Gm1786 antibody, Gm1787 antibody, Gm320 antibody, HZFW1 antibody, ring finger protein 39 antibody, RNF39 antibody, Rnf39 antibody

Background: Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.

Molecular Weight: 39 kDa (MW of target protein)