G2E3 antibody (N-Term)

Catalog No. ABIN631665

Product Details anti-G2E3 Antibody

Target: G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This G2E3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA1333 antibody was raised against the N terminal of KIAA1333

Purification: Affinity purified

Immunogen: KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA1333 Blocking Peptide, catalog no. 33R-4215, is also available for use as a blocking control in assays to test for specificity of this KIAA1333 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1333 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for G2E3

Target: G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))

Alternative Name: KIAA1333 (G2E3 Products)

Synonyms: KIAA1333 antibody, PHF7B antibody, sb:cb726 antibody, si:busm1-234g15.1 antibody, si:dz234g15.1 antibody, wu:fe02a06 antibody, wu:fe24c12 antibody, 6030408C04Rik antibody, 9030416F18 antibody, AW046379 antibody, D930034K21Rik antibody, mKIAA1333 antibody, RGD1310263 antibody, G2/M-phase specific E3 ubiquitin protein ligase antibody, G2/M-phase specific E3 ubiquitin ligase antibody, G2E3 antibody, g2e3 antibody, G2e3 antibody

Background: KIAA1333 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molecular Weight: 80 kDa (MW of target protein)