UBE2E1 antibody

Catalog No. ABIN631662

Product Details anti-UBE2E1 Antibody

Target: UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))

Reactivity: Human, Mouse, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2E1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UBE2 E1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2E1 Blocking Peptide, catalog no. 33R-7168, is also available for use as a blocking control in assays to test for specificity of this UBE2E1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2E1

Target: UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))

Alternative Name: UBE2E1 (UBE2E1 Products)

Background: UBE2E1 catalyzes the covalent attachment of ubiquitin to other proteins. UBE2E1 mediates the selective degradation of short-lived and abnormal proteins.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway