UBE2E1 antibody
-
- Target See all UBE2E1 Antibodies
- UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))
-
Reactivity
- Human, Mouse, Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE2E1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UBE2 E1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
- Top Product
- Discover our top product UBE2E1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE2E1 Blocking Peptide, catalog no. 33R-7168, is also available for use as a blocking control in assays to test for specificity of this UBE2E1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))
- Alternative Name
- UBE2E1 (UBE2E1 Products)
- Background
- UBE2E1 catalyzes the covalent attachment of ubiquitin to other proteins. UBE2E1 mediates the selective degradation of short-lived and abnormal proteins.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Ubiquitin Proteasome Pathway
-