UBE2L3 antibody (C-Term)

Catalog No. ABIN631658

Product Details anti-UBE2L3 Antibody

Target: UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2L3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBE2 L3 antibody was raised against the C terminal of UBE2 3

Purification: Affinity purified

Immunogen: UBE2 L3 antibody was raised using the C terminal of UBE2 3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2L3 Blocking Peptide, catalog no. 33R-4124, is also available for use as a blocking control in assays to test for specificity of this UBE2L3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2L3

Target: UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))

Alternative Name: UBE2L3 (UBE2L3 Products)

Background: UBE2L3(ubiquitin-conjugating enzyme E2L 3) Antibody The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s).

Molecular Weight: 17 kDa (MW of target protein)