WDR34 antibody (C-Term)

Catalog No. ABIN631651

Product Details anti-WDR34 Antibody

Target: WDR34 (WD Repeat Domain 34 (WDR34))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR34 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR34 antibody was raised against the C terminal of WDR34

Purification: Affinity purified

Immunogen: WDR34 antibody was raised using the C terminal of WDR34 corresponding to a region with amino acids SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR34 Blocking Peptide, catalog no. 33R-8605, is also available for use as a blocking control in assays to test for specificity of this WDR34 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR34

Target: WDR34 (WD Repeat Domain 34 (WDR34))

Alternative Name: WDR34 (WDR34 Products)

Synonyms: wdr34 antibody, zgc:171284 antibody, DKFZp469F164 antibody, MGC89396 antibody, DIC5 antibody, bA216B9.3 antibody, 3200002I06Rik antibody, WD repeat domain 34 antibody, WD repeat domain 34 L homeolog antibody, wdr34 antibody, WDR34 antibody, wdr34.L antibody, Wdr34 antibody

Background: WDR34 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Molecular Weight: 58 kDa (MW of target protein)