Rhotekin antibody (Middle Region)
-
- Target See all Rhotekin (RTKN) Antibodies
- Rhotekin (RTKN)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Rhotekin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Rhotekin antibody was raised against the middle region of RTKN
- Purification
- Affinity purified
- Immunogen
- Rhotekin antibody was raised using the middle region of RTKN corresponding to a region with amino acids IETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP
- Top Product
- Discover our top product RTKN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Rhotekin Blocking Peptide, catalog no. 33R-3952, is also available for use as a blocking control in assays to test for specificity of this Rhotekin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTKN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Rhotekin (RTKN)
- Alternative Name
- Rhotekin (RTKN Products)
- Synonyms
- RTKN antibody, rhotekin antibody, RTKN antibody, rtkn antibody, Rtkn antibody
- Background
- RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.
- Molecular Weight
- 63 kDa (MW of target protein)
-