SELENBP1 antibody (C-Term)
-
- Target See all SELENBP1 Antibodies
- SELENBP1 (Selenium Binding Protein 1 (SELENBP1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SELENBP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SELENBP1 antibody was raised against the C terminal of SELENBP1
- Purification
- Affinity purified
- Immunogen
- SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR
- Top Product
- Discover our top product SELENBP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SELENBP1 Blocking Peptide, catalog no. 33R-4604, is also available for use as a blocking control in assays to test for specificity of this SELENBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELENBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SELENBP1 (Selenium Binding Protein 1 (SELENBP1))
- Alternative Name
- SELENBP1 (SELENBP1 Products)
- Synonyms
- zgc:65844 antibody, hsbp antibody, lpsb antibody, sp56 antibody, sbp56 antibody, MGC82850 antibody, SELENBP1 antibody, LPSB antibody, SBP56 antibody, SP56 antibody, hSBP antibody, Lp56 antibody, Lpsb antibody, Selenbp2 antibody, selenbp1 antibody, SBP antibody, DL3055C antibody, FCAALL.79 antibody, selenium-binding protein 1 antibody, selenium binding protein 1 antibody, selenium binding protein 1 S homeolog antibody, selenium binding protein 1 L homeolog antibody, selenium-binding protein 1 antibody, selenbp1 antibody, SELENBP1 antibody, selenbp1.S antibody, Selenbp1 antibody, selenbp1.L antibody, SBP1 antibody
- Background
- SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-