MBOAT1 antibody (N-Term)

Catalog No. ABIN631638

Product Details anti-MBOAT1 Antibody

Target: MBOAT1 (Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBOAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MBOAT1 antibody was raised against the N terminal of MBOAT1

Purification: Affinity purified

Immunogen: MBOAT1 antibody was raised using the N terminal of MBOAT1 corresponding to a region with amino acids AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBOAT1 Blocking Peptide, catalog no. 33R-1017, is also available for use as a blocking control in assays to test for specificity of this MBOAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBOAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBOAT1

Target: MBOAT1 (Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1))

Alternative Name: MBOAT1 (MBOAT1 Products)

Synonyms: 1 antibody, LPEAT1 antibody, LPLAT antibody, LPLAT 1 antibody, LPSAT antibody, OACT1 antibody, dJ434O11.1 antibody, 9130215M02Rik antibody, BC023845 antibody, Moact1 antibody, Oact1 antibody, RGD1565521 antibody, RGD1565561 antibody, membrane bound O-acyltransferase domain containing 1 antibody, LOAG_15529 antibody, MBOAT1 antibody, Mboat1 antibody

Background: MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.

Molecular Weight: 56 kDa (MW of target protein)