PPP4C antibody

Catalog No. ABIN631624

Product Details anti-PPP4C Antibody

Target: PPP4C (Protein Phosphatase 4, Catalytic Subunit (PPP4C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP4C antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPP4 C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP4C Blocking Peptide, catalog no. 33R-9365, is also available for use as a blocking control in assays to test for specificity of this PPP4C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP4C

Target: PPP4C (Protein Phosphatase 4, Catalytic Subunit (PPP4C))

Alternative Name: PPP4C (PPP4C Products)

Synonyms: pp4 antibody, ppx antibody, pp4c antibody, pph3 antibody, MGC75928 antibody, PP4C-A antibody, gc:56413 antibody, ppp4c antibody, wu:fd05e08 antibody, zgc:56413 antibody, PP4 antibody, PP4C antibody, PPH3 antibody, PPP4 antibody, PPX antibody, 1110002D08Rik antibody, AU016079 antibody, Ppx antibody, protein phosphatase 4 catalytic subunit antibody, protein phosphatase 4, catalytic subunit a antibody, protein phosphatase 4, catalytic subunit antibody, protein phosphatase 4 catalytic subunit S homeolog antibody, ppp4c antibody, ppp4ca antibody, PPP4C antibody, Ppp4c antibody, ppp4c.S antibody

Background: PPP4C is a protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration.

Molecular Weight: 34 kDa (MW of target protein)