MAB21L1 antibody

Catalog No. ABIN631621

Product Details anti-MAB21L1 Antibody

Target: MAB21L1 (Mab-21-Like 1 (MAB21L1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAB21L1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MAB21 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAB21L1 Blocking Peptide, catalog no. 33R-3887, is also available for use as a blocking control in assays to test for specificity of this MAB21L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAB20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAB21L1

Target: MAB21L1 (Mab-21-Like 1 (MAB21L1))

Alternative Name: MAB21L1 (MAB21L1 Products)

Synonyms: MGC145860 antibody, cagr1 antibody, CAGR1 antibody, AW047968 antibody, mab-21-like 1 antibody, mab-21-like 1 L homeolog antibody, mab-21 like 1 antibody, mab-21-like 1 (C. elegans) antibody, mab21l1 antibody, mab21l1.L antibody, MAB21L1 antibody, Mab21l1 antibody

Background: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.

Molecular Weight: 41 kDa (MW of target protein)