GNL3L antibody
-
- Target See all GNL3L Antibodies
- GNL3L (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar)-Like (GNL3L))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GNL3L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GNL3 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
- Top Product
- Discover our top product GNL3L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GNL3L Blocking Peptide, catalog no. 33R-6234, is also available for use as a blocking control in assays to test for specificity of this GNL3L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNL3L (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar)-Like (GNL3L))
- Alternative Name
- GNL3L (GNL3L Products)
- Synonyms
- SI:zK13A21.8 antibody, flj10613 antibody, flj10613l antibody, si:dkey-13a21.8 antibody, zgc:110536 antibody, BC020354 antibody, guanine nucleotide binding protein-like 3 (nucleolar)-like antibody, guanine nucleotide binding protein-like 3 (nucleolar)-like S homeolog antibody, G protein nucleolar 3 like antibody, gnl3l antibody, gnl3l.S antibody, GNL3L antibody, Gnl3l antibody
- Background
- GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
- Molecular Weight
- 65 kDa (MW of target protein)
-