GAPDHS antibody (N-Term)
-
- Target See all GAPDHS Antibodies
- GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GAPDHS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GAPDHS antibody was raised against the N terminal of GAPDHS
- Purification
- Affinity purified
- Immunogen
- GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI
- Top Product
- Discover our top product GAPDHS Primary Antibody
-
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 1-408) antibody
GAPDHS Reactivity: Human WB, ELISA, IHC (p) Host: Mouse Monoclonal 2E3-2E10 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibodyGAPDHS Reactivity: Human WB, IHC (p), IHC Host: Mouse Monoclonal 1F6 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 104-134) antibodyGAPDHS Reactivity: Human WB, IHC (p), FACS Host: Rabbit Polyclonal RB16542 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 179-408) antibodyGAPDHS Reactivity: Human WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibodyGAPDHS Reactivity: Pig WB, IF Host: Mouse Monoclonal 1D4 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibodyGAPDHS Reactivity: Human, Pig WB, FACS, ICC Host: Mouse Monoclonal Hs-8 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 251-350) antibodyGAPDHS Reactivity: Mouse, Rat WB, ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 1-408) antibodyGAPDHS Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibodyGAPDHS Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibody (FITC)GAPDHS Reactivity: Human, Pig FACS Host: Mouse Monoclonal Hs-8 FITC
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GAPDHS Blocking Peptide, catalog no. 33R-7075, is also available for use as a blocking control in assays to test for specificity of this GAPDHS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDHS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))
- Alternative Name
- GAPDHS (GAPDHS Products)
- Synonyms
- GAPDS antibody, GAPDHS antibody, GAPD2 antibody, GAPDH-2 antibody, HSD-35 antibody, Gapd-s antibody, Gapds antibody, gapdh-2 antibody, cb350 antibody, fb71f08 antibody, fk58c09 antibody, g3pdh antibody, gapdh antibody, gapds antibody, wu:fb71f08 antibody, wu:fk58c09 antibody, zgc:76908 antibody, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic antibody, GAPDHS antibody, Gapdhs antibody, gapdhs antibody
- Background
- GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Regulation of Carbohydrate Metabolic Process
-
