DHDDS antibody (N-Term)

Catalog No. ABIN631604

Product Details anti-DHDDS Antibody

Target: DHDDS (Dehydrodolichyl Diphosphate Synthase (DHDDS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHDDS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DHDDS antibody was raised against the N terminal of DHDDS

Purification: Affinity purified

Immunogen: DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHDDS Blocking Peptide, catalog no. 33R-6864, is also available for use as a blocking control in assays to test for specificity of this DHDDS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHDDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHDDS

Target: DHDDS (Dehydrodolichyl Diphosphate Synthase (DHDDS))

Alternative Name: DHDDS (DHDDS Products)

Synonyms: wu:fd56c06 antibody, zgc:77088 antibody, CIT antibody, CPT antibody, DS antibody, HDS antibody, RP59 antibody, 3222401G21Rik antibody, W91638 antibody, dehydrodolichyl diphosphate synthase subunit antibody, dehydrodolichyl diphosphate synthase antibody, dehydrodolichyl diphosphate synthase subunit L homeolog antibody, DHDDS antibody, Dhdds antibody, dhdds antibody, dhdds.L antibody

Background: Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.

Molecular Weight: 39 kDa (MW of target protein)